Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Anti-EPS8 Antibody
| Applications | IHC |
| Reactivities | Expected from seq similarity: Human, Mouse, Rat, Dog, Pig |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SGVESFDEGSSH, from the C Terminus of the protein sequence according to NP_004438.3. |
Rabbit Polyclonal Anti-EPS8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPS8 antibody: synthetic peptide directed towards the middle region of human EPS8. Synthetic peptide located within the following region: VSKVPANITRQNSSSSDSGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIH |
Rabbit Polyclonal Anti-Eps8 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Eps8 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Eps8. Synthetic peptide located within the following region: VFNQITVQKAALEDSNGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH |
EPS8 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human EPS8 (NP_004438.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- EPS8