EPX rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human EPX |
EPX rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human EPX |
Rabbit Polyclonal Anti-EPX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPX antibody: synthetic peptide directed towards the middle region of human EPX. Synthetic peptide located within the following region: LAFRFGHTMLQPFMFRLDSQYRASAPNSHVPLSSAFFASWRIVYEGGIDP |
EPX Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | Unmodified |