Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal ERAS Antibody (N-term) (F66)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 51-81 amino acids from the N-terminal region of human ERAS. |
ERAS rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human |
Rabbit Polyclonal Anti-Eras Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Eras Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LPTKSSILDLSSGTPCTRSPEESHEAWAQCKDAGRQLPEYKAVVVGASGV |
Rabbit Polyclonal Anti-ERAS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ERAS Antibody: synthetic peptide directed towards the middle region of human ERAS. Synthetic peptide located within the following region: AQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAF |
Carrier-free (BSA/glycerol-free) ERAS mouse monoclonal antibody, clone OTI3A3 (formerly 3A3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ERAS Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ERAS |
ERAS mouse monoclonal antibody, clone OTI3A3 (formerly 3A3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ERAS mouse monoclonal antibody,clone 3A3, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ERAS mouse monoclonal antibody,clone 3A3, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ERAS mouse monoclonal antibody, clone OTI3A3 (formerly 3A3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- ERAS