Rabbit Polyclonal XPD Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal XPD Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Anti-ERCC2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ERCC2 antibody: synthetic peptide directed towards the N terminal of human ERCC2. Synthetic peptide located within the following region: KLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVS |
Carrier-free (BSA/glycerol-free) ERCC2 mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
XPD/ERCC2 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human XPD/XPD/ERCC2 (NP_001124339.1). |
Modifications | Unmodified |
ERCC2 mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ERCC2 mouse monoclonal antibody, clone OTI4B11 (formerly 4B11), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ERCC2 mouse monoclonal antibody, clone OTI4B11 (formerly 4B11), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ERCC2 mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |