Rabbit Polyclonal Anti-ERCC6L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC6L2 antibody is: synthetic peptide directed towards the N-terminal region of Human ERCC6L2. Synthetic peptide located within the following region: ELWCVMDWAVPGLLGSGTYFKKQFSDPVEHGQRHTATKRELATGRKAMQR |
RAD26L (ERCC6L2) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 233-263 amino acids from the Central region of human RAD26L |
Rabbit Polyclonal Anti-ERCC6L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC6L2 antibody is: synthetic peptide directed towards the C-terminal region of Human ERCC6L2. Synthetic peptide located within the following region: RDKVLLFSFSTKLLDVLQQYCMASGLDYRRLDGSTKSEERLKIVKEFNST |
9330134C04Rik Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
ERCC6L2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1262-1561 of human ERCC6L2 (NP_064592.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
