Antibodies

Jump to Filters
View as table Download
SPFH2 (ERLIN2) Rabbit Polyclonal Antibody
TA344331

USD 475.00

5 Days

Rabbit Polyclonal Anti-ERLIN2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ERLIN2 antibody: synthetic peptide directed towards the middle region of human ERLIN2. Synthetic peptide located within the following region: ASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN
SPFH2 (ERLIN2) Rabbit Polyclonal Antibody
TA590556

USD 409.00

In Stock

Rabbit Polyclonal SPFH2 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
SPFH2 (ERLIN2) Goat Polyclonal Antibody
TA303052

USD 375.00

5 Days

Goat Polyclonal Antibody against ERLIN2

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EDEPLETATKEN, from the C Terminus of the protein sequence according to NP_009106.1.
SPFH2 (ERLIN2) Rabbit Polyclonal Antibody
TA308471

USD 415.00

5 Days

Rabbit polyclonal antibody to ERLIN2 (ER lipid raft associated 2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 278 and 339 of SPFH2 (Uniprot ID#O94905)
SPFH2 (ERLIN2) Rabbit Polyclonal Antibody
TA375977

USD 220.00

3 Weeks

ERLIN2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-152 of human ERLIN2 (NP_001003790.1).
Modifications Unmodified