TXNDC4 (ERP44) (30-407) mouse monoclonal antibody, clone 3C7, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Human |
TXNDC4 (ERP44) (30-407) mouse monoclonal antibody, clone 3C7, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-TXNDC4 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TXNDC4 antibody: synthetic peptide directed towards the middle region of human TXNDC4. Synthetic peptide located within the following region: LHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDE |
Goat Polyclonal Antibody against TXNDC4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EQKDSDNYRVFER, from the internal region of the protein sequence according to NP_055866.1. |
ERP44 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human |
Immunogen | ERP44 antibody was raised against synthetic 20 amino acid peptide from C-terminus of human ERP44 / TXNDC4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset (100%); Monkey, Mouse, Rat, Hamster (95%); Bovine, Rabbit, Horse (90%); Bat, Dog, Panda, Pig (85%); Opossum, Turkey, Chicken, Lizard, Sea anemone (80%). |
ERP44 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
Conjugation | Unconjugated |
Immunogen | ERP44 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human ERP44 / TXNDC4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bat, Bovine, Hamster, Elephant, Panda, Horse, Rabbit, Pig, Opossum, Platypus (100%); Zebrafish (89%); Turkey, Chicken (83%). |
Rabbit Polyclonal Anti-ERP44 Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Immunogen | ERP44 antibody was raised against synthetic 20 amino acid peptide from internal region of human ERP44 / TXNDC4. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus (100%); Opossum, Stickleback, Medaka, Pufferfish, Zebrafish (95%). |
Rabbit Polyclonal Anti-ERP44 Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ERP44 antibody was raised against synthetic 19 amino acid peptide from internal region of human ERP44 / TXNDC4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Rat, Dog, Bovine, Hamster, Panda, Rabbit, Horse, Opossum, Turkey, Chicken, Platypus (95%); Mouse, Pig, Lizard (89%); Elephant (84%). |
Rabbit Polyclonal Anti-ERP44 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ERP44 |
Rabbit Polyclonal Anti-ERP44 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ERP44 |
ERP44 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ERP44 |
ERP44 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ERP44 |
ERP44 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 57-406 of human ERP44 (NP_055866.1). |
Modifications | Unmodified |