Antibodies

View as table Download

Rabbit Polyclonal Anti-TXNDC4 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TXNDC4 antibody: synthetic peptide directed towards the middle region of human TXNDC4. Synthetic peptide located within the following region: LHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDE

Goat Polyclonal Antibody against TXNDC4

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EQKDSDNYRVFER, from the internal region of the protein sequence according to NP_055866.1.

ERP44 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Immunogen ERP44 antibody was raised against synthetic 20 amino acid peptide from C-terminus of human ERP44 / TXNDC4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset (100%); Monkey, Mouse, Rat, Hamster (95%); Bovine, Rabbit, Horse (90%); Bat, Dog, Panda, Pig (85%); Opossum, Turkey, Chicken, Lizard, Sea anemone (80%).

ERP44 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen ERP44 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human ERP44 / TXNDC4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bat, Bovine, Hamster, Elephant, Panda, Horse, Rabbit, Pig, Opossum, Platypus (100%); Zebrafish (89%); Turkey, Chicken (83%).

Rabbit Polyclonal Anti-ERP44 Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen ERP44 antibody was raised against synthetic 20 amino acid peptide from internal region of human ERP44 / TXNDC4. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus (100%); Opossum, Stickleback, Medaka, Pufferfish, Zebrafish (95%).

Rabbit Polyclonal Anti-ERP44 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen ERP44 antibody was raised against synthetic 19 amino acid peptide from internal region of human ERP44 / TXNDC4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Rat, Dog, Bovine, Hamster, Panda, Rabbit, Horse, Opossum, Turkey, Chicken, Platypus (95%); Mouse, Pig, Lizard (89%); Elephant (84%).

Rabbit Polyclonal Anti-ERP44 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ERP44

Rabbit Polyclonal Anti-ERP44 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ERP44

ERP44 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ERP44

ERP44 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ERP44

ERP44 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 57-406 of human ERP44 (NP_055866.1).
Modifications Unmodified