Antibodies

View as table Download

Rabbit Polyclonal Anti-ESD Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ESD antibody: synthetic peptide directed towards the N terminal of human ESD. Synthetic peptide located within the following region: MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYW

Rabbit polyclonal anti-ESD antibody (Center)

Applications WB
Reactivities Human, Mouse, Rat (Predicted: Pig)
Conjugation Unconjugated
Immunogen This ESD antibody is generated from a rabbit immunized with a KLH conjugated synthetic peptide between 68-102 amino acids from the Central region of human ESD.

ESD Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-282 of human ESD (NP_001975.1).
Modifications Unmodified