Rabbit Polyclonal Anti-Etv2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Etv2 antibody: synthetic peptide directed towards the middle region of mouse Etv2. Synthetic peptide located within the following region: GHQSPAFTTPSKSNKQSDRATLTRYSKTNHRGPIQLWQFLLELLHDGARS |
Rabbit Polyclonal anti-ETV2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ETV2 antibody: synthetic peptide directed towards the N terminal of human ETV2. Synthetic peptide located within the following region: DTPTATAETCWKGTSSSLASFPQLDWGSALLHPEVPWGAEPDSQALPWSG |
Rabbit Polyclonal Anti-Etv2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Etv2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MDLWNWDEASLQEVPPGDKLTGLGAEFGFYFPEVALQEDTPITPMNVEGC |
ETV2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ETV2 |
Germany
Japan
United Kingdom
China
