Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-ETV4 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ETV4. |
Rabbit Polyclonal Anti-ETV4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ETV4 antibody: synthetic peptide directed towards the middle region of human ETV4. Synthetic peptide located within the following region: HSSVFQQPLDICHSFTSQGGGREPLPAPYQHQLSEPCPPYPQQSFKQEYH |
Rabbit Polyclonal Anti-ETV4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ETV4 antibody was raised against a peptide corresponding to 19 amino acids near the amino terminus of human ETV4. |
Carrier-free (BSA/glycerol-free) ETV4 mouse monoclonal antibody,clone OTI1A10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ETV4 mouse monoclonal antibody,clone OTI1E11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ETV4 mouse monoclonal antibody,clone OTI5C11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ETV4 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ETV4 |
ETV4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 79-178 of human ETV4 (NP_001977.1). |
| Modifications | Unmodified |
ETV4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-207 of human ETV4 (NP_001248368.1). |
| Modifications | Unmodified |
ETV4 mouse monoclonal antibody,clone OTI1A10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ETV4 mouse monoclonal antibody,clone OTI1A10, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ETV4 mouse monoclonal antibody,clone OTI1A10, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ETV4 mouse monoclonal antibody,clone OTI1A10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ETV4 mouse monoclonal antibody,clone OTI1E11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ETV4 mouse monoclonal antibody,clone OTI1E11, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ETV4 mouse monoclonal antibody,clone OTI1E11, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ETV4 mouse monoclonal antibody,clone OTI1E11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ETV4 mouse monoclonal antibody,clone OTI5C11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ETV4 mouse monoclonal antibody,clone OTI5C11, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ETV4 mouse monoclonal antibody,clone OTI5C11, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ETV4 mouse monoclonal antibody,clone OTI5C11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- ETV4