Germany
Japan
United Kingdom
China
Antibodies
View as table Download
ETV7 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ETV7 |
TA373003 is a possible alternative to TA349948.
Rabbit Polyclonal Anti-ETV7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ETV7 Antibody: synthetic peptide directed towards the N terminal of human ETV7. Synthetic peptide located within the following region: SLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRAL |
Rabbit Polyclonal Anti-ETV7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ETV7 antibody: synthetic peptide directed towards the C terminal of human ETV7. Synthetic peptide located within the following region: IIKKEPGQKLLFRFLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEIS |
Carrier-free (BSA/glycerol-free) ETV7 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ETV7 mouse monoclonal antibody, clone OTI2A10 (formerly 2A10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ETV7 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human ETV7 (NP_057219.1). |
| Modifications | Unmodified |
ETV7 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ETV7 mouse monoclonal antibody,clone 3B2, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ETV7 mouse monoclonal antibody,clone 3B2, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ETV7 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ETV7 mouse monoclonal antibody, clone OTI2A10 (formerly 2A10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ETV7 mouse monoclonal antibody,clone 2A10, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ETV7 mouse monoclonal antibody,clone 2A10, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ETV7 mouse monoclonal antibody, clone OTI2A10 (formerly 2A10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- ETV7