Antibodies

View as table Download

Rabbit Polyclonal Anti-EVX2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EVX2 antibody: synthetic peptide directed towards the N terminal of human EVX2. Synthetic peptide located within the following region: TTSASGSGLGSLHGGSGGSGGSAALGGSGSGADQVRRYRTAFTREQIARL

Rabbit Polyclonal Anti-EVX2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EVX2 antibody: synthetic peptide directed towards the N terminal of human LOC344191. Synthetic peptide located within the following region: MMERIRKEMILMERGLHSPTAGKRFSNLSNSAGNAVLEALENSQHPARLS

Rabbit Polyclonal Anti-EVX2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EVX2 antibody: synthetic peptide directed towards the middle region of human EVX2. Synthetic peptide located within the following region: GGAGAGGGSDFGCSAAAPRSESGFLPYSAAVLSKTAVSPPDQRDEAPLTR

Rabbit Polyclonal Anti-EVX2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EVX2 antibody: synthetic peptide directed towards the N terminal of human LOC344191. Synthetic peptide located within the following region: GELPAKGKFEIDTLFNLQHTGSESTVSSEISSAAESRKKPGHYSEAAAEA

Evx2 Antibody - N-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Evx2