Antibodies

View as table Download

Rabbit Polyclonal Anti-EXOC1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOC1 antibody: synthetic peptide directed towards the N terminal of human EXOC1. Synthetic peptide located within the following region: NVSSQLLEESVPSGENQSVTGGDEEVVDEYQELNAREEQDIEIMMEGCEY

Rabbit Polyclonal Anti-EXOC1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOC1 antibody: synthetic peptide directed towards the N terminal of human EXOC1. Synthetic peptide located within the following region: NCFLCATVTTERPVQVKVVKVKKSDKGDFYKRQIAWALRDLAVVDAKDAI

EXOC1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 645-894 of human EXOC1 (NP_001020095.1).
Modifications Unmodified