Germany
Japan
United Kingdom
China
Rabbit Polyclonal EXOC2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-EXOC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EXOC2 antibody is: synthetic peptide directed towards the N-terminal region of Human EXOC2. Synthetic peptide located within the following region: MLDLDNDTRPSVLGHLSQTASLKRGSSFQSGRDDTWRYKTPHRVAFVEKL |
EXOC2 Rabbit polyclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human EXOC2 (NP_060773.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- EXOC2