Antibodies

Jump to Filters
View as table Download
EXOC8 (Center) Rabbit Polyclonal Antibody
AP51481PU-N

USD 450.00

2 Weeks

EXOC8 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 367-397 amino acids from the Central region of Human EXOC8
EXOC8 Rabbit Polyclonal Antibody
TA337558

USD 375.00

5 Days

Rabbit Polyclonal Anti-EXOC8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOC8 antibody: synthetic peptide directed towards the N terminal of human EXOC8. Synthetic peptide located within the following region: MAMAMSDSGASRLRRQLESGGFEARLYVKQLSQQSDGDRDLQEHRQRIQA