Rabbit polyclonal anti-ENDOGL1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ENDOGL1. |
Rabbit polyclonal anti-ENDOGL1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ENDOGL1. |
Rabbit Polyclonal Anti-Endogl1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Endogl1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TETRRYTNHALSYDQAKRVPRWVLEHISKDKIIGDADRKHCKFKPDPSVP |
EXOG rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human EXOG |
EXOG rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human EXOG |