Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-ECM1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human ECM1. |
Rabbit Polyclonal Anti-ECM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ECM1 antibody is: synthetic peptide directed towards the middle region of Human ECM1. Synthetic peptide located within the following region: QDRSQGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSH |
ECM1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ECM1 |
ECM1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human ECM1 (NP_001189787.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ECM1