Antibodies

Jump to Filters
View as table Download
EFEMP1 Rabbit Polyclonal Antibody
TA346066

USD 475.00

5 Days

Rabbit Polyclonal Anti-EFEMP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EFEMP1 antibody: synthetic peptide directed towards the middle region of human EFEMP1. Synthetic peptide located within the following region: NENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSSV
EFEMP1 (C-term) Rabbit Polyclonal Antibody
AP23481PU-N

USD 525.00

2 Weeks

EFEMP1 (C-term) rabbit polyclonal antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide - KLH conjugated
EFEMP1 (N-term) Rabbit Polyclonal Antibody
AP51374PU-N

USD 450.00

2 Weeks

EFEMP1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 126-156aa) of human Fibulin-3
EFEMP1 Rabbit Polyclonal Antibody
TA306794

USD 430.00

5 Days

Rabbit Polyclonal Fibulin 3 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fibulin 3 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human Fibulin 3.
EFEMP1 Rabbit Polyclonal Antibody
TA312976

USD 345.00

In Stock

Rabbit polyclonal anti-EFEMP1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EFEMP1.
EFEMP1 Rabbit Polyclonal Antibody
TA346013

USD 475.00

5 Days

Rabbit Polyclonal Anti-EFEMP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EFEMP1 antibody: synthetic peptide directed towards the middle region of human EFEMP1. Synthetic peptide located within the following region: GNENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSS
EFEMP1 Rabbit Polyclonal Antibody
TA346014

USD 475.00

5 Days

Rabbit Polyclonal Anti-EFEMP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EFEMP1 antibody: synthetic peptide directed towards the middle region of human EFEMP1. Synthetic peptide located within the following region: KYMSIRSDRSVPSDIFQIQATTIYANTINTFRIKSGNENGEFYLRQTSPV
EFEMP1 Rabbit Polyclonal Antibody
AP21171PU-N

USD 370.00

2 Weeks

EFEMP1 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
EFEMP1 Mouse Monoclonal Antibody [Clone ID: OTI1D9]
CF503772

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) EFEMP1 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
EFEMP1 Mouse Monoclonal Antibody [Clone ID: OTI1D9]
TA503772

USD 379.00

In Stock

EFEMP1 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
EFEMP1 Mouse Monoclonal Antibody [Clone ID: OTI1D9]
TA503772S

USD 159.00

2 Days

EFEMP1 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated