Germany
Japan
United Kingdom
China
Antibodies
View as table Download
EFNB3 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human EFNB3 |
Rabbit Polyclonal Anti-EFNB3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Efnb3 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Efnb3. Synthetic peptide located within the following region: AGAGGAMCWRRRRAKPSESRHPGPGSFGRGGSLGLGGGGGMGPREAEPGE |
Rabbit anti Ephrin B3 Polyclonal Antibody
| Reactivities | Human |
| Immunogen | Recombinant protein encoding aa 135-341 of human Ephrin B3 expressed in E.Coli. |
Rabbit Polyclonal Anti-EFNB3 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human EFNB3 |
EFNB3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
EFNB3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 28-226 of human EFNB3 (NP_001397.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- EFNB3