Rabbit Polyclonal Anti-EGR1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGR1 antibody: synthetic peptide directed towards the middle region of human EGR1. Synthetic peptide located within the following region: PSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSS |
Rabbit polyclonal anti-EGR1/2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EGR1/2. |
Rabbit polyclonal anti-EGR-1 antibody
| Applications | IHC, WB |
| Reactivities | Chimpanzee, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This affinity-purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 94-108 (eqpyehltaesfpdi) of Human EGR-1. |
Rabbit Polyclonal Anti-EGR1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGR1 antibody: synthetic peptide directed towards the N terminal of human EGR1. Synthetic peptide located within the following region: DNYPKLEEMMLLSNGAPQFLGAAGAPEGSGSNSSSSSSGGGGGGGGGSNS |
Rabbit Polyclonal Anti-Egr1 Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Egr1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PATTSFPSPVPTSYSSPGSSTYPSPAHSGFPSPSVATTFASVPPAFPTQV |
Rabbit Polyclonal Anti-EGR1 Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGR1 antibody: synthetic peptide directed towards the N terminal of mouse EGR1. Synthetic peptide located within the following region: GTPEGSGGNSSSSTSSGGGGGGGSNSGSSAFNPQGEPSEQPYEHLTTESF |
EGR1 (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human EGR1 |
Rabbit anti-Egr1 polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human Egr1. |
Anti-EGR1 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 87-337 amino acids of human early growth response 1early growth response 1 |
EGR1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human EGR1 |
| Modifications | Unmodified |
EGR1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human EGR1 (NP_001955.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
