Rabbit Polyclonal Anti-ELF2 Antibody - middle region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Elf2 antibody is: synthetic peptide directed towards the middle region of Rat Elf2. Synthetic peptide located within the following region: TCPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYY |
Rabbit Polyclonal anti-ELF2 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ELF2 antibody: synthetic peptide directed towards the N terminal of human ELF2. Synthetic peptide located within the following region: TSPDSHEPMKKKKVGRKPKTQQSPISNGSPELGIKKKPREGKGNTTYLWE |
ELF2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human ELF2 (NP_006865.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
