Antibodies

Jump to Filters
View as table Download
HIF 2 alpha (EPAS1) Rabbit Polyclonal Antibody
TA309641

USD 479.00

2 Weeks

Rabbit Polyclonal HIF-2 alpha Antibody

Applications IHC, WB
Reactivities Fish, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A peptide derived from the C-terminus of mouse/human HIF-2 alpha protein.
Epas1 (202-240) Rabbit Polyclonal Antibody
AP23352PU-N

USD 405.00

2 Weeks

Epas1 (202-240) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence at N-terminus of Rat HIF-2-alpha (202-240)
HIF 2 alpha (EPAS1) (N-term) Rabbit Polyclonal Antibody
AP51440PU-N

USD 450.00

2 Weeks

HIF 2 alpha (EPAS1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 127-154 amino acids from the N-terminal region of Human HIF2A
HIF 2 alpha (EPAS1) Rabbit Polyclonal Antibody
TA330214

USD 375.00

5 Days

Rabbit Polyclonal Anti-EPAS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPAS1 antibody: synthetic peptide directed towards the middle region of human EPAS1. Synthetic peptide located within the following region: ESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGD
HIF 2 alpha (EPAS1) Mouse Monoclonal Antibody [Clone ID: OTI2G5]
CF801746

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) EPAS1 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
HIF 2 alpha (EPAS1) Mouse Monoclonal Antibody [Clone ID: OTI2A6]
CF801749

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) EPAS1 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
HIF 2 alpha (EPAS1) Mouse Monoclonal Antibody [Clone ID: OTI6G3]
CF809645

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) EPAS1 mouse monoclonal antibody,clone OTI6G3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
HIF 2 alpha (EPAS1) Rabbit Polyclonal Antibody
TA375916

USD 220.00

3 Weeks

EPAS1/HIF2α Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 588-870 of human EPAS1/HIF2α (NP_001421.2).
Modifications Unmodified
HIF 2 alpha (EPAS1) Mouse Monoclonal Antibody [Clone ID: OTI2A6]
TA801749

USD 379.00

In Stock

EPAS1 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated