Antibodies

View as table Download

EPB41L2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human EPB41L2

Rabbit polyclonal anti-EPB41L2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human EPB41L2.

EPB4IL2 (EPB41L2) (347-357) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Human
Immunogen Synthetic peptide from an internal region of human EPB41L2

Rabbit Polyclonal Anti-EPB41L2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPB41L2 antibody: synthetic peptide directed towards the middle region of human EPB41L2. Synthetic peptide located within the following region: AKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQAST

Goat Polyclonal Antibody against EPB41L2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RREVRSPTKAPH, from the internal region of the protein sequence according to NP_001422.1.

EPB41L2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human EPB41L2 (NP_001186317.1).
Modifications Unmodified