Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-EPHA7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPHA7 Antibody: A synthesized peptide derived from human EPHA7 |
Antibodies
View as table Download
Rabbit polyclonal anti-EPHA7 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EPHA7. |
Rabbit polyclonal EPHA7 (Tyr791) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EPHA7around the phosphorylation site of tyrosine 791. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-EPHA7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPHA7 antibody is: synthetic peptide directed towards the C-terminal region of Human EPHA7. Synthetic peptide located within the following region: SNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGIL |
Rabbit Polyclonal Anti-EPHA7 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human EPHA7 |
EPHA7 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human EPHA7 |
EPHA7 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 28-190 of human EPHA7 (NP_004431.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- EPHA7