Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-EPO Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human EPO |
Rabbit Polyclonal Anti-EPO Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPO antibody: synthetic peptide directed towards the middle region of human EPO. Synthetic peptide located within the following region: KEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD |
Rabbit Polyclonal Anti-EPO Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPO Antibody: A synthesized peptide derived from human EPO |
EPO mouse monoclonal antibody, clone Epo2
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EPO mouse monoclonal antibody,clone OTI5D8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
EPO Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Produced from sera of rabbits immunized with highly pure Recombinant Human EPO. Anti-Human EPO-specific antibody was purified by affinity chromatography employing an immobilized Human EPO matrix. |
EPO Antibody (biotin)
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Produced from sera of rabbits immunized with highly pure Recombinant Human EPO. Anti-Human EPO-specific antibody was purified by affinity chromatography and then biotinylated. |
EPO mouse monoclonal antibody,clone OTI5D8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
EPO mouse monoclonal antibody,clone OTI5D8, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
EPO mouse monoclonal antibody,clone OTI5D8, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
EPO mouse monoclonal antibody,clone OTI5D8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- EPO