Antibodies

Jump to Filters
View as table Download
Epiphycan (EPYC) Rabbit Polyclonal Antibody
TA338172

USD 375.00

5 Days

Rabbit Polyclonal Anti-EPYC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPYC antibody is: synthetic peptide directed towards the middle region of Human EPYC. Synthetic peptide located within the following region: FYSRFNRIKKINKNDFASLSDLKRIDLTSNLISEIDEDAFRKLPQLRELV
Epiphycan (EPYC) Rabbit Polyclonal Antibody
TA360065

USD 360.00

5 Days

EPYC Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human EPYC