Germany
Japan
United Kingdom
China
Goat Anti-ELKS / RAB6IP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence YGSARSVGKVEPS-C, from the N Terminus of the protein sequence according to NP_829883.1; NP_829884.1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-ERC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERC1 antibody: synthetic peptide directed towards the C terminal of human ERC1. Synthetic peptide located within the following region: KLMADNYEDDHFKSSHSNQTNHKPSPDQIIQPLLELDQNRSKLKLYIGHL |
Rabbit Polyclonal Anti-ERC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERC1 antibody is: synthetic peptide directed towards the C-terminal region of Human ERC1. Synthetic peptide located within the following region: KKSAQMLEEARRREDNLNDSSQQLQDSLRKKDDRIEELEEALRESVQITA |
ERC1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 700-850 of human ERC1 (NP_829884.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ERC1