Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Anti-KEO4 / ERLIN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EALEPSGENVIQNKE, from the C Terminus of the protein sequence according to NP_006450.2. |
Rabbit Polyclonal Anti-ERLIN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERLIN1 antibody: synthetic peptide directed towards the N terminal of human ERLIN1. Synthetic peptide located within the following region: KNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFNKIH |
ERLIN1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ERLIN1 |
ERLIN1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 259-348 of human ERLIN1 (NP_006450.2). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- ERLIN1