Germany
Japan
United Kingdom
China
USD 516.00
In Stock
Antibodies
View as table Download
Rabbit polyclonal ESRRA Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ESRRA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 131-159 amino acids from the Central region of human ESRRA. |
Rabbit Polyclonal ERR alpha/NR3B1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an N-terminal portion of human Estrogen Related Receptor alpha (within residues 1-50). [Swiss-Prot# P11474] |
Rabbit Polyclonal Anti-Esrra Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Esrra antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKL |
Rabbit Polyclonal Anti-ESRRA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ESRRA antibody: synthetic peptide directed towards the N terminal of human ESRRA. Synthetic peptide located within the following region: KEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVN |
Rabbit Polyclonal Anti-ESRRA Antibody (Ligand-binding Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ESRRA / ERR Alpha antibody was raised against synthetic 15 amino acid peptide from ligand-binding domain of human ESRRA. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Bat, Dog, Horse, Pig (100%). |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ESRRA mouse monoclonal antibody, clone OTI9D10 (formerly 9D10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ESRRA mouse monoclonal antibody, clone OTI1E6 (formerly 1E6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ESRRA mouse monoclonal antibody, clone OTI2C10 (formerly 2C10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ESRRA mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ESRRA mouse monoclonal antibody, clone OTI3G10 (formerly 3G10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ESRRA mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ESRRA mouse monoclonal antibody,clone OTI2H9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 465.00
In Stock
ESRRA Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-423 of human ESRRA (NP_004442.3). |
| Modifications | Unmodified |
ESRRA Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-423 of human ESRRA (NP_004442.3). |
| Modifications | Unmodified |
USD 379.00
In Stock
ESRRA mouse monoclonal antibody, clone OTI9D10 (formerly 9D10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ESRRA mouse monoclonal antibody, clone OTI9D10 (formerly 9D10), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ESRRA mouse monoclonal antibody, clone OTI9D10 (formerly 9D10), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 159.00
2 Days
ESRRA mouse monoclonal antibody, clone OTI9D10 (formerly 9D10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 379.00
In Stock
ESRRA mouse monoclonal antibody, clone OTI1E6 (formerly 1E6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ESRRA mouse monoclonal antibody, clone OTI1E6 (formerly 1E6), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ESRRA mouse monoclonal antibody, clone OTI1E6 (formerly 1E6), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 159.00
2 Days
ESRRA mouse monoclonal antibody, clone OTI1E6 (formerly 1E6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
USD 379.00
In Stock
ESRRA mouse monoclonal antibody, clone OTI2C10 (formerly 2C10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ESRRA mouse monoclonal antibody, clone OTI2C10 (formerly 2C10), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ESRRA mouse monoclonal antibody, clone OTI2C10 (formerly 2C10), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 159.00
2 Days
ESRRA mouse monoclonal antibody, clone OTI2C10 (formerly 2C10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 379.00
In Stock
ESRRA mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ESRRA mouse monoclonal antibody, clone OTI1C6 (formerly 1C6), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ESRRA mouse monoclonal antibody, clone OTI1C6 (formerly 1C6), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 159.00
2 Days
ESRRA mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 379.00
In Stock
ESRRA mouse monoclonal antibody, clone OTI3G10 (formerly 3G10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ESRRA mouse monoclonal antibody, clone OTI3G10 (formerly 3G10), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ESRRA mouse monoclonal antibody, clone OTI3G10 (formerly 3G10), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 159.00
2 Days
ESRRA mouse monoclonal antibody, clone OTI3G10 (formerly 3G10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 379.00
In Stock
ESRRA mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ESRRA mouse monoclonal antibody, clone OTI2G5 (formerly 2G5), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ESRRA mouse monoclonal antibody, clone OTI2G5 (formerly 2G5), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 159.00
2 Days
ESRRA mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- ESRRA