Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal ETS1 (Thr38) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ETS1 around the phosphorylation site of threonine 38 (L-L-TP-P-S). |
| Modifications | Phospho-specific |
Rabbit monoclonal antibody against ETS1(clone EPR546(2))
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ETS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ETS1 antibody: synthetic peptide directed towards the N terminal of human ETS1. Synthetic peptide located within the following region: TFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMN |
Anti-ETS1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 209 amino acids of human v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) |
Rabbit Polyclonal anti-ETS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ETS1 antibody is: synthetic peptide directed towards the middle region of Human ETS1. Synthetic peptide located within the following region: FQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNG |
ETS1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ETS1 |
ETS1 Rabbit polyclonal Antibody
| Applications | ELISA, ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
Active filters
Target Symbol
- ETS1