Rabbit Polyclonal Anti-EXOC1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EXOC1 antibody: synthetic peptide directed towards the N terminal of human EXOC1. Synthetic peptide located within the following region: NVSSQLLEESVPSGENQSVTGGDEEVVDEYQELNAREEQDIEIMMEGCEY |
Rabbit Polyclonal Anti-EXOC1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EXOC1 antibody: synthetic peptide directed towards the N terminal of human EXOC1. Synthetic peptide located within the following region: NCFLCATVTTERPVQVKVVKVKKSDKGDFYKRQIAWALRDLAVVDAKDAI |
EXOC1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 645-894 of human EXOC1 (NP_001020095.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China