Antibodies

Jump to Filters
View as table Download
EXOC7 Goat Polyclonal Antibody
TA303105

USD 375.00

5 Days

Goat Polyclonal Antibody against EXOC7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DNIKNDPDKEYN, from the internal region of the protein sequence according to NP_001013861.1; NP_056034.2.
EXOC7 Rabbit Polyclonal Antibody
TA307917

USD 415.00

5 Days

Rabbit polyclonal antibody to EXOC7 (exocyst complex component 7)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 74 and 335 of EXOC7 (Uniprot ID#Q9UPT5)
EXOC7 Rabbit Polyclonal Antibody
TA308116

USD 415.00

5 Days

Rabbit polyclonal antibody to EXOC7 (exocyst complex component 7)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 493 and 735 of EXOC7 (Uniprot ID#Q9UPT5)
EXOC7 Rabbit Polyclonal Antibody
TA334943

USD 375.00

5 Days

Rabbit Polyclonal Anti-EXOC7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOC7 antibody is: synthetic peptide directed towards the C-terminal region of Human EXOC7. Synthetic peptide located within the following region: FLHNNYNYILKSLEKSELIQLVAVTQKTAERSYREHIEQQIQTYQRSWLK
EXOC7 Rabbit Polyclonal Antibody
TA359399

USD 360.00

5 Days

EXOC7 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human EXOC7