Antibodies

View as table Download

Rabbit Polyclonal Anti-CYP2A7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2A7 antibody: synthetic peptide directed towards the middle region of human CYP2A7. Synthetic peptide located within the following region: KVEHNQRTLDPNSPQDFIDSFLIHMQEEEKNPNTEFYLKNLMMSTLNLFI

Goat Anti-EYA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TDPTAEYSTIHSP, from the internal region of the protein sequence according to NP_742057.1; NP_000494.2; NP_742056.1.

EYA1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human EYA1.

EYA1 Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human EYA1

EYA1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of human EYA1

Eya1 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated

EYA1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-250 of human EYA1 (NP_742055.1).
Modifications Unmodified

EYA1/4 Rabbit polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide from human protein at AA range: 271-320