Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-Protease-activated Receptor-4 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)HLRGQRWPFGEAA(S)R, corresponding to amino acid residues 136-150 of human PAR-4. Cys 149 was replaced with Ser. 1st extracellular loop. |
Rabbit polyclonal PAR4 (Cleaved-Gly48) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human PAR4. |
Rabbit Polyclonal Anti-F2RL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-F2RL3 Antibody is: synthetic peptide directed towards the C-terminal region of Human F2RL3. Synthetic peptide located within the following region: LNSCVDPFIYYYVSAEFRDKVRAGLFQRSPGDTVASKASAEGGSRGMGTH |
F2RL3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-150 of human F2RL3 (NP_003941.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- F2RL3