Antibodies

View as table Download

Rabbit polyclonal anti-PAR4 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PAR4.

Rabbit Polyclonal Anti-Protease-activated Receptor-4 (extracellular)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)HLRGQRWPFGEAA(S)R, corresponding to amino acid residues 136-150 of human PAR-4. Cys 149 was replaced with Ser. 1st extracellular loop.

Rabbit polyclonal PAR4 (Cleaved-Gly48) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human PAR4.

Rabbit Polyclonal Anti-F2RL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-F2RL3 Antibody is: synthetic peptide directed towards the C-terminal region of Human F2RL3. Synthetic peptide located within the following region: LNSCVDPFIYYYVSAEFRDKVRAGLFQRSPGDTVASKASAEGGSRGMGTH

F2RL3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-150 of human F2RL3 (NP_003941.2).
Modifications Unmodified