Rabbit Polyclonal Factor VIII Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human Factor VIII. |
Rabbit Polyclonal Factor VIII Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human Factor VIII. |
Factor VIII Sheep Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | F8 / FVIII / Factor VIII antibody was raised against human Factor VIIIC (F. VIII) purified from F. VIII concentrate. |
Rabbit Polyclonal Factor VIII Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal Anti-F8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-F8 antibody: synthetic peptide directed towards the C terminal of human F8. Synthetic peptide located within the following region: IMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQ |
Factor VIII (F8) mouse monoclonal antibody, clone F8 2.2.9, Purified
Applications | IHC |
Reactivities | Human |
Mouse monoclonal Anti-Factor VIII Clone RFF-VIII:c/8
Reactivities | Human |
Conjugation | Unconjugated |
Mouse monoclonal Anti-Factor VIII:c light chain Clone RFF-VIII:c/5
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti Coagulation Factor VIII (Fused form) Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to fused portion of human FVIII protein surrounding to HQREI domain with depletion of cleavage terminus. |
Rabbit anti Coagulation Factor VIII (Cleaved form, N-term) Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to N-term of the cleavage form VLLKRHHQR of human FVIII protein. It also identical to mouse, chicken origin. |
Rabbit anti Coagulation Factor VIII (Cleaved form, C-Term) Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to C-term of the cleavage form around sequence EITRTTLQS of human FVIII protein. It also identical to mouse, chicken origin. |
Factor VIII Rabbit polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthesized peptide derived from the C-terminal region of human Factor VIII. at AA rangle: 2130-2210 |