Antibodies

Jump to Filters
View as table Download
FABP9 Mouse Monoclonal Antibody [Clone ID: AT13F9]
AM50091PU-N

USD 340.00

2 Weeks

FABP9 mouse monoclonal antibody, clone AT13F9, Purified

Applications ELISA, WB
Reactivities Human
FABP9 Mouse Monoclonal Antibody [Clone ID: AT13F9]
AM50091PU-S

USD 230.00

2 Weeks

FABP9 mouse monoclonal antibody, clone AT13F9, Purified

Applications ELISA, WB
Reactivities Human
FABP9 Rabbit Polyclonal Antibody
TA338319

USD 375.00

5 Days

Rabbit Polyclonal Anti-FABP9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FABP9 antibody is: synthetic peptide directed towards the middle region of Human FABP9. Synthetic peptide located within the following region: SFKLGEEFDETTADNRKVKSTITLENGSMIHVQKWLGKETTIKRKIVDEK