Antibodies

Jump to Filters
View as table Download
FAM13A Rabbit Polyclonal Antibody
TA335609

USD 375.00

5 Days

Rabbit Polyclonal Anti-FAM13A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FAM13A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM13A. Synthetic peptide located within the following region: DFEDNFFRQNGRNVQKEDRTPMAEEYSEYKHIKAKLRLLEVLISKRDTDS
FAM13A Rabbit Polyclonal Antibody
TA376096

USD 220.00

3 Weeks

FAM13A Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human FAM13A (NP_055698.2).
Modifications Unmodified