Antibodies

Jump to Filters
View as table Download
NIP30 (FAM192A) Rabbit Polyclonal Antibody
TA335456

USD 375.00

5 Days

Rabbit Polyclonal Anti-FAM192A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FAM192A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM192A. Synthetic peptide located within the following region: KPIETKNKFSQAKLLAGAVKHKSSESGNSVKRLKPDPEPDDKNQEPSSCK
NIP30 (FAM192A) Rabbit Polyclonal Antibody
TA376101

USD 220.00

3 Weeks

FAM192A Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human FAM192A.