Antibodies

Jump to Filters
View as table Download
FAM20C Rabbit Polyclonal Antibody
TA372540

USD 380.00

4 Weeks

FAM20C rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human FAM20C
FAM20C (C-term) Rabbit Polyclonal Antibody
AP51278PU-N

USD 512.00

2 Weeks

FAM20C (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 443-471 amino acids from the C-terminal region of human Dentin matrix protein 4.
FAM20C Rabbit Polyclonal Antibody
TA338410

USD 375.00

5 Days

Rabbit Polyclonal Anti-FAM20C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FAM20C antibody: synthetic peptide directed towards the middle region of human FAM20C. Synthetic peptide located within the following region: CFYGECSYYCSTEHALCGKPDQIEGSLAAFLPDLSLAKRKTWRNPWRRSY
FAM20C Rabbit Polyclonal Antibody
TA338411

USD 375.00

5 Days

Rabbit Polyclonal Anti-FAM20C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FAM20C antibody: synthetic peptide directed towards the C terminal of human FAM20C. Synthetic peptide located within the following region: NETFIIHLDNGRGFGKYSHDELSILVPLQQCCRIRKSTYLRLQLLAKEEY