Antibodies

Jump to Filters
View as table Download
FAM32A Rabbit Polyclonal Antibody
TA335635

USD 375.00

5 Days

Rabbit Polyclonal Anti-FAM32A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FAM32A Antibody is: synthetic peptide directed towards the N-terminal region of Human FAM32A. Synthetic peptide located within the following region: DKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQEKRQMERILKKAS
FAM32A Rabbit Polyclonal Antibody
TA376106

USD 220.00

3 Weeks

FAM32A Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human FAM32A.