Rabbit Polyclonal Anti-FANCA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FANCA antibody: synthetic peptide directed towards the N terminal of human FANCA. Synthetic peptide located within the following region: KLSLSKVIDCDSSEAYANHSSSFIGSALQDQASRLGVPVGILSAGMVASS |
Rabbit polyclonal anti-FANCA antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human FANCA |
Rabbit polyclonal anti-FANCA antibody
| Applications | WB |
| Reactivities | Chimpanzee, Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 995-1009 of human FANCA protein. |
Rabbit Polyclonal FACA/FANCA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide within residues 1200-1300 of the human FANCA protein. [Swiss-Prot# O15360] |
Rabbit Polyclonal FACA/FANCA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of human FANCA (within residues 800-900). [UniProt# O15360] |
FANCA Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-275 of human FANCA (NP_000126.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
