Germany
Japan
United Kingdom
China
FANCE rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human FANCE |
Antibodies
View as table Download
Rabbit Polyclonal Anti-FANCE Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FANCE Antibody: synthetic peptide directed towards the middle region of human FANCE. Synthetic peptide located within the following region: SPQAPDPEEEENRDSQQPGKRRKDSEEEAASPEGKRVPKRLRCWEEEEDH |
FANCE rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human FANCE |
FANCE Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-255 of human FANCE (NP_068741.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- FANCE