Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-FAP-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAP-1 Antibody: A synthesized peptide derived from human FAP-1 |
Antibodies
View as table Download
Rabbit polyclonal Fibroblast Activation Protein antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of mouse FAP protein. |
Rabbit Polyclonal Anti-FAP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FAP antibody is: synthetic peptide directed towards the C-terminal region of Human FAP. Synthetic peptide located within the following region: SWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTA |
Rabbit Polyclonal Anti-FAP Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | FAP Alpha antibody was raised against synthetic 17 amino acid peptide from extracellular domain of human FAP. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Horse (100%); Panda, Bovine, Pig (94%); Elephant, Dog (88%); Rat, Bat, Platypus (82%). |
Rabbit Polyclonal Anti-FAP Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FAP |
FAP rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FAP |
Fibroblast activation protein-α (FAP) Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 26-280 of human fibroblast activation protein-α (Fibroblast activation protein-α (FAP)) (NP_004451.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- FAP