Antibodies

View as table Download

Fas (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence at the N-terminal of Rat FAS, different from the related Mouse sequence by seven amino acids.

Rabbit polyclonal anti-FAS antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Fas.

FAS Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Fas Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Mouse Anti-Human CD95 (APO-1/Fas) Purified

Applications FC
Reactivities Human

CD95 (FAS) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 280-330 of Human CD95.

CD95 (FAS) (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen conjugated synthetic peptide selected from the Center region of human FAS

CD95 (FAS) (323-327) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Peptide sequence around aa.323~327 derived from human Fas .

CD95 (FAS) (323-327) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Peptide sequence around aa.323~327 derived from human Fas .

Goat Anti-FAS / CD95 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KTCRKHRKENQGSH, from the internal region of the protein sequence according to NP_000034.1; NP_690610.1; NP_690611.1.

Mouse Anti-Mouse CD95 (APO-1/Fas) Purified (50 ug)

Applications FC
Reactivities Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-FAIM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FAIM2 antibody is: synthetic peptide directed towards the N-terminal region of Human FAIM2. Synthetic peptide located within the following region: QVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVD

Mouse Monoclonal FAS (C-terminus) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit anti CD95 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) FAS mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) FAS mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)

Applications WB
Reactivities Human
Conjugation Unconjugated

Anti-FAS Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 156-335 amino acids of human Fas (TNF receptor superfamily, member 6)

Fas Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-335 of human Fas (NP_000034.1).
Modifications Unmodified

Fas Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified

Phospho-Fas-Y291 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Modifications Phospho Y291

Fas Rabbit polyclonal Antibody

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Fas

Recombinant Anti-Fas (Clone R-125224)

Applications ELISA, FC
Reactivities Human
Conjugation Unconjugated

Recombinant Anti-Fas (Clone R-125224)

Applications ELISA, FC
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques.

sFas Receptor Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Produced from sera of rabbits immunized with highly pure recombinant Human sFas Receptor. Anti-Human sFas Receptor specific antibody was purified by affinity chromatography employing an immobilized Human sFas Receptor matrix.

sFas Receptor Antibody (biotin)

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Produced from sera of rabbits immunized with highly pure recombinant Human sFas Receptor. Anti-Human sFas Receptor specific antibody was purified by affinity chromatography and then biotinylated.

FAS mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)

Applications WB
Reactivities Human
Conjugation Unconjugated

FAS mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)

Applications WB
Reactivities Human
Conjugation Unconjugated

FAS mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)

Applications WB
Reactivities Human
Conjugation Unconjugated

FAS mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)

Applications WB
Reactivities Human
Conjugation Unconjugated