Rabbit polyclonal FBXO28 Antibody (C-term)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This FBXO28 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 339-368 amino acids from the C-terminal region of human FBXO28. |
Rabbit Polyclonal Anti-FBXO28 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FBXO28 Antibody: synthetic peptide directed towards the middle region of human FBXO28. Synthetic peptide located within the following region: KVQEQQKQLQDQDQKLLEQTQIIGEQNARLAELERKLREVMESAVGNSSG |
Rabbit Polyclonal Anti-FBXO28 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FBXO28 Antibody: synthetic peptide directed towards the middle region of human FBXO28. Synthetic peptide located within the following region: ELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAIDSLRKSKRLRNRK |
FBXO28 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 91-312 of human FBXO28 (NP_055991.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China