Antibodies

View as table Download

Rabbit polyclonal anti-FBXO4 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This whole rabbit serum was prepared by repeated immunizations with a synthetic peptide derived from sequences unique to the N-terminus of FBX4 and conserved between the human and murine proteins (see link below for the full-length sequence of the mouse gene product).

FBXO4 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 231~260 amino acids from the Center region of human FBXO4

Goat Anti-FBXO4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PTAGLPQRQIDG, from the internal region of the protein sequence according to NP_036308.1; NP_277019.1.

Rabbit Polyclonal Anti-FBXO4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBXO4 antibody: synthetic peptide directed towards the middle region of human FBXO4. Synthetic peptide located within the following region: TSAVNKMFSRHNEGDDQQGSRYSVIPQIQKVCEVVDGFIYVANAEAHKSK

Rabbit Polyclonal Anti-FBXO4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBXO4 antibody: synthetic peptide directed towards the middle region of human FBXO4. Synthetic peptide located within the following region: KRMPCFYLAHELHLNLLNHPWLVQDTEAETLTGFLNGIEWILEEVESKRA

FBXO4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 138-387 of human FBXO4 (NP_036308.1).
Modifications Unmodified