Rabbit Polyclonal Anti-FBXO42 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FBXO42 antibody: synthetic peptide directed towards the middle region of human FBXO42. Synthetic peptide located within the following region: RSMDEAPCVNGRWGTLRPRAQRQTPSGSREGSLSPARGDGSPILNGGSLS |
Carrier-free (BSA/glycerol-free) FBXO42 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
FBXO42 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FBXO42 |
FBXO42 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 468-717 of human FBXO42 (NP_061867.1). |
| Modifications | Unmodified |
FBXO42 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 468-717 of human FBXO42 (NP_061867.1). |
| Modifications | Unmodified |
USD 420.00
5 Days
USD 420.00
5 Days
USD 420.00
5 Days
FBXO42 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
5 Days
FBXO42 mouse monoclonal antibody,clone 1C7, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
FBXO42 mouse monoclonal antibody,clone 1C7, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
FBXO42 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
5 Days
Germany
Japan
United Kingdom
China
