Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-Ficolin-1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 320 of rat Ficolin-1 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-FCN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FCN1 antibody: synthetic peptide directed towards the middle region of human FCN1. Synthetic peptide located within the following region: GSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEA |
Rabbit Polyclonal Anti-FCN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FCN1 antibody: synthetic peptide directed towards the middle region of human FCN1. Synthetic peptide located within the following region: HQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDND |
FCN1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-326 of human FCN1 (NP_001994.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- FCN1