Antibodies

Jump to Filters
View as table Download
FCRL4 (C-term) Rabbit Polyclonal Antibody
AP51644PU-N

USD 450.00

2 Weeks

FCRL4 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 480 - 507 amino acids from the C-terminal region of human FCRL4
FCRL4 Rabbit Polyclonal Antibody
TA339576

USD 375.00

5 Days

Rabbit Polyclonal Anti-FCRL4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FCRL4 antibody: synthetic peptide directed towards the N terminal of human FCRL4. Synthetic peptide located within the following region: FKGERVTLTCNGFQFYATEKTTWYHRHYWGEKLTLTPGNTLEVRESGLYR
FCRL4 Rabbit Polyclonal Antibody
TA339577

USD 375.00

5 Days

Rabbit Polyclonal Anti-FCRL4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FCRL4 antibody: synthetic peptide directed towards the N terminal of human FCRL4. Synthetic peptide located within the following region: KIIKIQELFPHPELKATDSQPTEGNSVNLSCETQLPPERSDTPLHFNFFR
FCRL4 Rabbit Polyclonal Antibody
TA376195

USD 220.00

3 Weeks

FCRL4 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 120-387 of human FCRL4 (NP_112572.1).
Modifications Unmodified